PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g001790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 805aa    MW: 87548.6 Da    PI: 6.0988
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g001790.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.9e-21137192156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe++F+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Csa02g001790.1 137 KKRYHRHTPQQIQELESMFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 192
                     688999***********************************************999 PP

2START2122.2e-663265451206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                     ela++a++elvk+a +eep+Wvks     +++n+de++++f+++k     +ea+r+sg+v+ ++  lve+l+d++ +W+e+++    +a+t++ i
  Csa02g001790.1 326 ELALTAMDELVKLAHSEEPLWVKSLdgerDELNQDEYMRTFSSTKPtgLATEASRTSGMVIINSLALVETLMDSN-RWTEMFPcnvaRATTTDII 419
                     5899*************************************9999999***************************.******************* PP

                     CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
           START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                     s g      galqlm+aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+++ ++++ ss+v+R  +lpSg++++++sng+skvtwveh++++
  Csa02g001790.1 420 SGGmagtinGALQLMNAELQVLSPLVPvRNVNFLRFCKQHAEGVWAVVDVSIEPIRENSGSSPVIR--RLPSGCVVQDMSNGYSKVTWVEHAEYD 512
                     ***********************************************************9******..*************************** PP

                     SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++h+l+r+l++sgl +g ++w+atlqrqce+
  Csa02g001790.1 513 ENQIHQLYRPLLRSGLGFGSQRWLATLQRQCEC 545
                     *******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-20124194IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-22125194IPR009057Homeodomain-like
PROSITE profilePS5007117.297134194IPR001356Homeobox domain
SMARTSM003899.5E-18135198IPR001356Homeobox domain
CDDcd000861.56E-18136194No hitNo description
PfamPF000462.0E-18137192IPR001356Homeobox domain
PROSITE patternPS000270169192IPR017970Homeobox, conserved site
PROSITE profilePS5084842.172317548IPR002913START domain
CDDcd088753.54E-112321544No hitNo description
SuperFamilySSF559611.73E-29321545No hitNo description
SMARTSM002342.2E-39326545IPR002913START domain
PfamPF018527.7E-60326545IPR002913START domain
SuperFamilySSF559611.95E-21564788No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 805 aa     Download sequence    Send to blast
MNFGSLFDNT PGGASTGARL LSGLSYGNHT AATNVLPGGA MAQAAAAASL FSPPLTKSVY  60
ASSGLSLALE QPERGGGTNN RGEASMRNNN VGGGGDNFDG SVNRRSREEE HESRSGSDNV  120
EGISGEDQDA ADKPPRKKRY HRHTPQQIQE LESMFKECPH PDEKQRLELS KRLCLETRQV  180
KFWFQNRRTQ MKTQLERHEN ALLRQENDKL RNENMSIREA MRNPICTNCG GPAMLGDVSL  240
EEHHLRIENA RLKDELDRVC NLTGKFLGHH HNHHYNSSLE LAVGTNNNGG NFAFPPDFGG  300
GACLPPPQQQ QQTGINGIDQ KSVLLELALT AMDELVKLAH SEEPLWVKSL DGERDELNQD  360
EYMRTFSSTK PTGLATEASR TSGMVIINSL ALVETLMDSN RWTEMFPCNV ARATTTDIIS  420
GGMAGTINGA LQLMNAELQV LSPLVPVRNV NFLRFCKQHA EGVWAVVDVS IEPIRENSGS  480
SPVIRRLPSG CVVQDMSNGY SKVTWVEHAE YDENQIHQLY RPLLRSGLGF GSQRWLATLQ  540
RQCECLAVLM SSSVTAQDNT SITPGGRKSM LKLAQRMTFN FCSGISAPSV HNWSKLTVGN  600
VDPDVRVMTR KSVDDPGEPP GIVLSAATSV WLPASPQRLF DFLRNERMRC EWDILSNGGP  660
MQEMAHIAKG QDQGVSLLRS NAMNANQSSM LILQETCIDA SGALVVYAPV DIPAMHVVMN  720
GGDSSYVALL PSGFAVLPDG GMDGGSSGDG EQRPVGGGSL LTVAFQILVN NLPTAKLTVE  780
SVETVNNLIS CTVQKIRAAL QCES*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2269680.0AK226968.1 Arabidopsis thaliana mRNA for homeodomain protein AHDP, complete cds, clone: RAFL09-36-B10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010427345.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLR0H8W00.0R0H8W0_9BRAS; Uncharacterized protein
STRINGAT4G00730.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein